PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18087.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 175aa    MW: 20348.2 Da    PI: 5.0712
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18087.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS147.41.4e-452172159333
       GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                eetgerL +fA+++++p++f+++++ +++ l+ + ++++ +E++aV ++++l  +l+e+ +le+    ++k+v++l+P v+vv+e ea+hns+ F++rf+
  PK18087.1   2 EETGERLLSFAKTMNIPLSFKIVMVPDMSHLKEDLFELDCNETVAVYSSYSLRIFLSEPDQLEH----LMKVVRNLNPCVMVVTEIEANHNSPVFVNRFI 97 
                79********************9999******************************88888888....******************************** PP

       GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                eal +y a fd+le  + re+e+r++    ++g  i+n+va eg++r+ rh t   W++ +++ GFk v+ls++ 
  PK18087.1  98 EALFFYGAYFDCLEDFMKREDENRMVCGSLYFGTGIKNMVASEGKQRKIRHVTIDVWKAFFTRYGFKDVELSSSS 172
                ************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.9291175IPR005202Transcription factor GRAS
PfamPF035144.8E-432172IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
XEETGERLLS FAKTMNIPLS FKIVMVPDMS HLKEDLFELD CNETVAVYSS YSLRIFLSEP  60
DQLEHLMKVV RNLNPCVMVV TEIEANHNSP VFVNRFIEAL FFYGAYFDCL EDFMKREDEN  120
RMVCGSLYFG TGIKNMVASE GKQRKIRHVT IDVWKAFFTR YGFKDVELSS SSLYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-144175163335GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097794.13e-86hypothetical protein L484_004208
TrEMBLW9RU084e-86W9RU08_9R
STRINGPOPTR_0010s15370.15e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.18e-31RGA-like protein 3